MED1, Recombinant, Human, aa878-1031, His-SUMO-Tag (Mediator of RNA Polymerase II Transcription Subunit 1)

Artikelnummer: USB-374184
Artikelname: MED1, Recombinant, Human, aa878-1031, His-SUMO-Tag (Mediator of RNA Polymerase II Transcription Subunit 1)
Artikelnummer: USB-374184
Hersteller Artikelnummer: 374184
Alternativnummer: USB-374184-20,USB-374184-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (PubMed:10406464, PubMed:11867769, PubMed:12037571, PubMed:12218053, PubMed:12556447, PubMed:14636573, PubMed:15340084, PubMed:15471764, PubMed:15989967, PubMed:16574658, PubMed:9653119). Acts as a coactivator for GATA1-mediated transcriptional activation during erythroid differentiation of K562 erythroleukemia cells (PubMed:24245781). Source: Recombinant protein corresponding to aa878-1031 from human MED1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~32.2kD Amino Acid Sequence: FGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 32.2
UniProt: Q15648
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.