MPV17, Recombinant, Human, aa1-176, His-SUMO-Tag (Protein Mpv17)

Artikelnummer: USB-374256
Artikelname: MPV17, Recombinant, Human, aa1-176, His-SUMO-Tag (Protein Mpv17)
Artikelnummer: USB-374256
Hersteller Artikelnummer: 374256
Alternativnummer: USB-374256-20,USB-374256-100,USB-374256-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Involved in mitochondria homeostasis. May be involved in the metabolism of reactive oxygen species and control of oxidative phosphorylation and mitochondrial DNA (mtDNA) maintenance. Source: Recombinant protein corresponding to aa1-176 from human MPV17, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.7kD Amino Acid Sequence: MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 35.7
UniProt: P39210
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.