MPZ, Recombinant, Human, aa30-156, His-Tag (Myelin Protein P0)

Produktübersicht

• Artikelname: MPZ, Recombinant, Human, aa30-156, His-Tag (Myelin Protein P0)
• Artikelnummer: USB-374258
• Hersteller Artikelnummer: 374258
• Alternativnummer: USB-374258-20,USB-374258-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Creation of an Extracellular domain membrane face which guides the wrapping process and ultimately compacts adjacent lamellae. Source: Partial recombinant protein corresponding to aa30-156 from human MPZ, fused to His-Tag at N-terminal, expressed in Yeast. AA Sequence: IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• UniProt: P25189
• Reinheit: ~90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.