MRPL1, Recombinant, Human, aa51-324, His-SUMO-Tag (39S Ribosomal Protein L1, Mitochondrial)

Produktübersicht

• Artikelname: MRPL1, Recombinant, Human, aa51-324, His-SUMO-Tag (39S Ribosomal Protein L1, Mitochondrial)
• Artikelnummer: USB-374265
• Hersteller Artikelnummer: 374265
• Alternativnummer: USB-374265-20,USB-374265-100,USB-374265-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa51-324 from human MRPL1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.3kD Amino Acid Sequence: KKTKKGAKEKTPDEKKDEIEKIKAYPYMEGEPEDDVYLKRLYPRQIYEVEKAVHLLKKFQILDFTSPKQSVYLDLTLDMALGKKKNVEPFTSVLSLPYPFASEINKVAVFTENASEVKIAEENGAAFAGGTSLIQKIWDDEIVADFYVAVPEIMPELNRLRKKLNKKYPKLSRNSIGRDIPKMLELFKNGHEIKVDEERENFLQTKIATLDMSSDQIAANLQAVINEVCRHRPLNLGPFVVRAFLRSSTSEGLLLKIDPLLPKEVKNEESEKED Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 47.3
• UniProt: Q9BYD6
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.