MRPL9, Recombinant, Human, aa60-267, GST-Tag (39S Ribosomal Protein L9, Mitochondrial)

Artikelnummer: USB-374274
Artikelname: MRPL9, Recombinant, Human, aa60-267, GST-Tag (39S Ribosomal Protein L9, Mitochondrial)
Artikelnummer: USB-374274
Hersteller Artikelnummer: 374274
Alternativnummer: USB-374274-20,USB-374274-100,USB-374274-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa60-267 from human MRPL9, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~50.9kD Amino Acid Sequence: WKVPLAGEGRKPRLHRRHRVYKLVEDTKHRPKENLELILTQSVENVGVRGDLVSVKKSLGRNRLLPQGLAVYASPENKKLFEEEKLLRQEGKLEKIQTKAGEATVKFLKSCRLEVGMKNNVKWELNPEIVARHFFKNLGVVVAPHTLKLPEEPITRWGEYWCEVTVNGLDTVRVPMSVVNFEKPKTKRYKYWLAQQAAKAMAPTSPQI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 50.9
UniProt: Q9BYD2
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.