Ms4a1, Recombinant, Mouse aa132-291, His-SUMO-Tag, (B-lymphocyte Antigen CD20)

Artikelnummer: USB-374279
Artikelname: Ms4a1, Recombinant, Mouse aa132-291, His-SUMO-Tag, (B-lymphocyte Antigen CD20)
Artikelnummer: USB-374279
Hersteller Artikelnummer: 374279
Alternativnummer: USB-374279-20,USB-374279-100
Hersteller: US Biological
Kategorie: Molekularbiologie
This protein may be involved in the regulation of B-cell activation and proliferation. Source: Partial recombinant protein corresponding to aa132-291 from mouse Ms4a1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.1kD Amino Acid Sequence: ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 34.1
UniProt: P19437
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.