MSRB3, Recombinant, Human, aa1-185, GST-Tag (Methionine-R-sulfoxide Reductase B3)

Artikelnummer: USB-374289
Artikelname: MSRB3, Recombinant, Human, aa1-185, GST-Tag (Methionine-R-sulfoxide Reductase B3)
Artikelnummer: USB-374289
Hersteller Artikelnummer: 374289
Alternativnummer: USB-374289-20,USB-374289-100,USB-374289-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine. Isoform 2 is essential for hearing. Source: Recombinant protein corresponding to aa1-185 from human MSRB3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.0kD Amino Acid Sequence: MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 47
UniProt: Q8IXL7
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.