Metallothioneins have a high content of cysteine residues that bind various heavy metals. Source: Recombinant full length protein corresponding to aa1-60 from danio rerio Metallothionein-1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22kD Amino Acid Sequence: MDPCECAKTGACNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGTSCCQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
