MT2731, Recombinant, Mycobacterium Tuberculosis, aa1-81, His-Tag (Antitoxin MT2731)

Produktübersicht

• Artikelname: MT2731, Recombinant, Mycobacterium Tuberculosis, aa1-81, His-Tag (Antitoxin MT2731)
• Artikelnummer: USB-374300
• Hersteller Artikelnummer: 374300
• Alternativnummer: USB-374300-20,USB-374300-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Antitoxin component of a toxin-antitoxin (TA) module. Neutralizes the effect of cognate toxin MT2730. Source: Recombinant protein corresponding to aa1-81 from mycobacterium tuberculosis MT2731, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~9.7kD Amino Acid Sequence: MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDPP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 9.7
• UniProt: P9WJ10
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.