MTB12, Recombinant, Mycobacterium Tuberculosis, aa49-168, His-Tag (Low Molecular Weight Antigen Mtb12)

Artikelnummer: USB-374304
Artikelname: MTB12, Recombinant, Mycobacterium Tuberculosis, aa49-168, His-Tag (Low Molecular Weight Antigen Mtb12)
Artikelnummer: USB-374304
Hersteller Artikelnummer: 374304
Alternativnummer: USB-374304-20,USB-374304-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May play a role in the development of protective immune responses. Source: Recombinant protein corresponding to aa49-168 from mycobacterium tuberculosis mtb12, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~14.1kD Amino Acid Sequence: DPASAPDVPTAAQLTSLLNSLADPNVSFANKGSLVEGGIGGTEARIADHKLKKAAEHGDLPLSFSVTNIQPAAAGSATADVSVSGPKLSSPVTQNVTFVNQGGWMLSRASAMELLQAAGN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 14.1
UniProt: P9WIN6
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.