Mup11, Recombinant, Mouse, aa1-151, His-Tag (Major Urinary Proteins 11 and 8)

Artikelnummer: USB-374323
Artikelname: Mup11, Recombinant, Mouse, aa1-151, His-Tag (Major Urinary Proteins 11 and 8)
Artikelnummer: USB-374323
Hersteller Artikelnummer: 374323
Alternativnummer: USB-374323-20,USB-374323-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales. Source: Recombinant protein corresponding to aa1-151 from mouse Major Urinary Proteins 11 and 8, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~21.6kD Amino Acid Sequence: REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 21.6
UniProt: P04938
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.