Mup2, Recombinant, Mouse, aa19-180, His-Tag (Major Urinary Protein 2)

Produktübersicht

• Artikelname: Mup2, Recombinant, Mouse, aa19-180, His-Tag (Major Urinary Protein 2)
• Artikelnummer: USB-374324
• Hersteller Artikelnummer: 374324
• Alternativnummer: USB-374324-20,USB-374324-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales. Source: Recombinant protein corresponding to aa19-180 from mouse Mup2, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.7kD Amino Acid Sequence: EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 22.7
• UniProt: P11589
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.