Mybpc3, Recombinant, Rat, aa645-864, His-Tag (Myosin-binding Protein C, Cardiac-Type)

Artikelnummer: USB-374336
Artikelname: Mybpc3, Recombinant, Rat, aa645-864, His-Tag (Myosin-binding Protein C, Cardiac-Type)
Artikelnummer: USB-374336
Hersteller Artikelnummer: 374336
Alternativnummer: USB-374336-20,USB-374336-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role. Source: Recombinant protein corresponding to aa645-864 from rat Mybpc3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~26.1kD Amino Acid Sequence: PKIHLDCPGSTPDTIVVVAGNKLRLDVPISGDPAPTVIWQKTITQGKKASAGPPPGAPEDAGADEEWVFDKKLLCETEGRVRVETTKDRSVFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCIVQWEPPAYDGGQPVLGYILERKKKKSYRWMRLNFDLLRELSHEARRMIEGVAYEMRVYAVNAVGMSRPSPASQPF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 26.1
UniProt: P56741
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.