MYL1, Recombinant, Human, aa1-150, GST-Tag (Myosin Light Chain 1/3, Skeletal Muscle Isoform)

Produktübersicht

• Artikelname: MYL1, Recombinant, Human, aa1-150, GST-Tag (Myosin Light Chain 1/3, Skeletal Muscle Isoform)
• Artikelnummer: USB-374344
• Hersteller Artikelnummer: 374344
• Alternativnummer: USB-374344-20,USB-374344-100,USB-374344-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Regulatory light chain of myosin. Does not bind calcium. Source: Recombinant protein corresponding to aa1-150 from human MYL1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.7kD Amino Acid Sequence: MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 43.7
• UniProt: P05976
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.