MYL2, Recombinant, Human, aa8-164, His-Tag (Myosin Regulatory Light Chain 2, Ventricular/Cardiac Muscle Isoform)

Produktübersicht

• Artikelname: MYL2, Recombinant, Human, aa8-164, His-Tag (Myosin Regulatory Light Chain 2, Ventricular/Cardiac Muscle Isoform)
• Artikelnummer: USB-374345
• Hersteller Artikelnummer: 374345
• Alternativnummer: USB-374345-20,USB-374345-100,USB-374345-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa8-164 from human MYL2, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~21.8kD Amino Acid Sequence: KRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 21.8
• UniProt: P10916
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.