N16.1 Matrix Protein, Recombinant, Pinctada Fucata, aa24-131, His-Tag

Artikelnummer: USB-374358
Artikelname: N16.1 Matrix Protein, Recombinant, Pinctada Fucata, aa24-131, His-Tag
Artikelnummer: USB-374358
Hersteller Artikelnummer: 374358
Alternativnummer: USB-374358-20,USB-374358-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May be specifically involved in the formation of the nacreous layer. Source: Recombinant protein corresponding to aa24-131 from pinctada fucata N16.1 Matrix Protein, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~14.9kD Amino Acid Sequence: AYHKKCGRYSYCWIPYDIERDRRDNGGKKYCFCRYAWSPWQCNEEERYEWLRCGMRFYSLCCYTDDDNGNGNGNGNGNGLNYLKSLYGGYGNGNGEFREEYIDERYDN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 14.9
UniProt: Q9TVT2
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.