N6AMT1, Recombinant, Human, aa1-186, GST-Tag (HemK Methyltransferase Family Member 2)

Artikelnummer: USB-374359
Artikelname: N6AMT1, Recombinant, Human, aa1-186, GST-Tag (HemK Methyltransferase Family Member 2)
Artikelnummer: USB-374359
Hersteller Artikelnummer: 374359
Alternativnummer: USB-374359-20,USB-374359-100,USB-374359-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Heterodimeric methyltransferase that catalyzes N5-methylation of ETF1 on Gln-185, using S-adenosyl L-methionine as methyl donor. ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated. May play a role in the modulation of arsenic-induced toxicity. May be involved in the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid. Source: Recombinant protein corresponding to aa1-186 from human N6AMT1, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~46.8kD Amino Acid Sequence: MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGKNGREVMDRFFPLVPDLLSPKGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 46.8
UniProt: Q9Y5N5
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.