N6AMT2, Recombinant, Human, aa2-214, His-SUMO-Tag (N(6)-adenine-specific DNA Methyltransferase 2)

Produktübersicht

• Artikelname: N6AMT2, Recombinant, Human, aa2-214, His-SUMO-Tag (N(6)-adenine-specific DNA Methyltransferase 2)
• Artikelnummer: USB-374360
• Hersteller Artikelnummer: 374360
• Alternativnummer: USB-374360-20,USB-374360-100,USB-374360-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

S-adenosyl-L-methionine-dependent protein-lysine N-methyltransferase that methylates elongation factor 1-alpha. Source: Recombinant protein corresponding to aa2-214 from human N6AMT2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.4kD Amino Acid Sequence: SDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDCGI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 40.4
• UniProt: Q8WVE0
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.