NANOS2, Recombinant, Human, aa1-138, His-SUMO-Tag (Nanos Homolog 2)

Artikelnummer: USB-374370
Artikelname: NANOS2, Recombinant, Human, aa1-138, His-SUMO-Tag (Nanos Homolog 2)
Artikelnummer: USB-374370
Hersteller Artikelnummer: 374370
Alternativnummer: USB-374370-20,USB-374370-100,USB-374370-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays a key role in the sexual differentiation of germ cells by promoting the male fate but suppressing the female fate. Represses the female fate pathways by suppressing meiosis, which in turn results in the promotion of the male fate. Maintains the suppression of meiosis by preventing STRA8 expression, which is required for preiotic DNA replication, after CYP26B1 is decreased. Regulates the localization of the CCR4-NOT deadenylation complex to P-bodies and plays a role in recruiting the complex to trigger the degradation of mRNAs involved in meiosis. Required for the maintenance of the spermatogonial stem cell population. Not essential for the assembly of P-bodies but is required for the maintenance of their normal state. Source: Recombinant protein corresponding to aa1-138 from human NANOS2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.1kD Amino Acid Sequence: MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 31.1
UniProt: P60321
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.