NAPG, Recombinant, Human, aa1-312, GST-Tag (Gamma-soluble NSF Attachment Protein)

Artikelnummer: USB-374371
Artikelname: NAPG, Recombinant, Human, aa1-312, GST-Tag (Gamma-soluble NSF Attachment Protein)
Artikelnummer: USB-374371
Hersteller Artikelnummer: 374371
Alternativnummer: USB-374371-20,USB-374371-100,USB-374371-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus. Source: Recombinant protein corresponding to aa1-312 from human NAPG, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~61.7kD Amino Acid Sequence: MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENDERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 61.7
UniProt: Q99747
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.