NDUFA3, Recombinant, Human, aa2-84, GST-Tag (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 3)

Artikelnummer: USB-374389
Artikelname: NDUFA3, Recombinant, Human, aa2-84, GST-Tag (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 3)
Artikelnummer: USB-374389
Hersteller Artikelnummer: 374389
Alternativnummer: USB-374389-20,USB-374389-100,USB-374389-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Source: Recombinant protein corresponding to aa2-84 from human NDUFA3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.1kD Amino Acid Sequence: AARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 36.1
UniProt: O95167
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.