NGFRAP1, Recombinant, Human, aa1-111, GST-Tag (Protein BEX3)

Artikelnummer: USB-374417
Artikelname: NGFRAP1, Recombinant, Human, aa1-111, GST-Tag (Protein BEX3)
Artikelnummer: USB-374417
Hersteller Artikelnummer: 374417
Alternativnummer: USB-374417-20,USB-374417-100,USB-374417-1
Hersteller: US Biological
Kategorie: Molekularbiologie
May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death. May play an important role in the pathogenesis of neurogenetic diseases. Full length recombinant protein corresponding to aa1-111 from human NGFRAP1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40kD Amino Acid Sequence: MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 40
UniProt: Q00994
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.