NKTR Recombinant, Human, aa10-175, His-SUMO-Tag (NK-tumor Recognition Protein)

Artikelnummer: USB-374426
Artikelname: NKTR Recombinant, Human, aa10-175, His-SUMO-Tag (NK-tumor Recognition Protein)
Artikelnummer: USB-374426
Hersteller Artikelnummer: 374426
Alternativnummer: USB-374426-20,USB-374426-100,USB-374426-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Component of a putative tumor-recognition complex. Involved in the function of NK cells. Source: Recombinant protein corresponding to aa10-175 from human NKTR, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.4kD Amino Acid Sequence: HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 34.4
UniProt: P30414
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.