Nmes1, Recombinant, Mouse, aa1-83, His-SUMO-Tag (Normal Mucosa of Esophagus-specific Gene 1 Protein)

Artikelnummer: USB-374432
Artikelname: Nmes1, Recombinant, Mouse, aa1-83, His-SUMO-Tag (Normal Mucosa of Esophagus-specific Gene 1 Protein)
Artikelnummer: USB-374432
Hersteller Artikelnummer: 374432
Alternativnummer: USB-374432-20,USB-374432-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-83 from mouse Nmes1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~25.6kD Amino Acid Sequence: MGVFQILMKNKELIPLAFFISVAATGATSFALYALKKTDVVIDRKRNPEPWEMVDPTQPQKLITINQQWKPVEELQKVRRATR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 25.6
UniProt: Q810Q5
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.