NOL3, Recombinant, Human, aa1-208, His-SUMO-Tag (Nucleolar Protein 3)

Artikelnummer: USB-374436
Artikelname: NOL3, Recombinant, Human, aa1-208, His-SUMO-Tag (Nucleolar Protein 3)
Artikelnummer: USB-374436
Hersteller Artikelnummer: 374436
Alternativnummer: USB-374436-20,USB-374436-100,USB-374436-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Isoform 1: May be involved in RNA splicing. Source: Recombinant protein corresponding to aa1-208 from human NOL3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.6kD Amino Acid Sequence: MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 38.6
UniProt: O60936
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.