Non-specific Lipid-transfer Protein 1, Recombinant, Prunus Persica, aa1-91, His-SUMO-Tag

Produktübersicht

• Artikelname: Non-specific Lipid-transfer Protein 1, Recombinant, Prunus Persica, aa1-91, His-SUMO-Tag
• Artikelnummer: USB-374437
• Hersteller Artikelnummer: 374437
• Alternativnummer: USB-374437-20,USB-374437-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues. Source: Recombinant full length protein corresponding to aa1-91 from prunus persica Non-specific lipid-transfer protein 1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~25.2kD Amino Acid Sequence: ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 25.2
• UniProt: P81402
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.