NOX4, Recombinant, Rat, aa210-424, His-Tag (NADPH Oxidase 4)

Produktübersicht

• Artikelname: NOX4, Recombinant, Rat, aa210-424, His-Tag (NADPH Oxidase 4)
• Artikelnummer: USB-374445
• Hersteller Artikelnummer: 374445
• Alternativnummer: USB-374445-20,USB-374445-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB. Source: Recombinant protein corresponding to aa210-424 from rat NOX4, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~40.6kD Amino Acid Sequence: GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 40.6
• UniProt: Q924V1
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.