Nqo2, Recombinant, Rat, aa1-231, His-SUMO-Tag (Ribosyldihydronicotinamide Dehydrogenase [Quinone])

Artikelnummer: USB-374463
Artikelname: Nqo2, Recombinant, Rat, aa1-231, His-SUMO-Tag (Ribosyldihydronicotinamide Dehydrogenase [Quinone])
Artikelnummer: USB-374463
Hersteller Artikelnummer: 374463
Alternativnummer: USB-374463-20,USB-374463-100
Hersteller: US Biological
Kategorie: Molekularbiologie
The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. Source: Recombinant protein corresponding to aa1-231 from rat Nqo2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.3kD Amino Acid Sequence: MAGKKVLLVYAHQEPKSFNGSMKQVAVEELSKQGCTVTVSDLYTMNFEPRATRNDVTGALSNPEVFKYGIEAYEAYKKKALTSDILEEQRKVQEADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDVPGFYDSGFLKDKLALLSFTTGGTAEMYTKAGVNGDFRYFLWPLQHGTLHFCGFKVLAPQISFGPEVSSEEQRKVMLASWVQRLKSIWKEEPIHCTPSWYFQG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 42.3
UniProt: Q6AY80
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.