NSP4, Recombinant, Rotavirus A, aa52-175, His-SUMO-Tag (Non-structural Glycoprotein 4)

Artikelnummer: USB-374481
Artikelname: NSP4, Recombinant, Rotavirus A, aa52-175, His-SUMO-Tag (Non-structural Glycoprotein 4)
Artikelnummer: USB-374481
Hersteller Artikelnummer: 374481
Alternativnummer: USB-374481-20,USB-374481-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Involved in virus morphogenesis. Functions as a receptor for the immature double-layered inner capsid particle (ICP) which transiently buds into the lumen of the rough endoplasmic reticulum during viral maturation. Enterotoxin that causes a phospholipase C-dependent elevation of the intracellular calcium concentration in host intestinal mucosa cells. Increased concentration of intracellular calcium disrupts the cytoskeleton and the tight junctions, raising the paracellular permeability. Potentiates chloride ion secretion through a calcium ion-dependent signaling pathway, inducing age-dependent diarrhea. To perform this enterotoxigenic role in vivo, NSP4 is probably released from infected enterocytes in a soluble form capable of diffusing within the intestinal lumen and interacting with the plasma membrane receptors on neighboring epithelial cells. Possible receptors for NSP4 are alpha-1/beta-1 and alpha-2/beta-1 integrin heterodimers. Source: Partial recombinant protein corresponding to aa52-175 from rotavirus A NSP4, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~30.6kD Amino Acid Sequence: PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEWESGKNPYEPREVTAAM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 30.6
UniProt: A2T3Q0
Reinheit: ~90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.