NUDT2, Recombinant, Human, aa1-147, GST-Tag (Bis(5-nucleosyl)-tetraphosphatase [asymmetrical])

Artikelnummer: USB-374514
Artikelname: NUDT2, Recombinant, Human, aa1-147, GST-Tag (Bis(5-nucleosyl)-tetraphosphatase [asymmetrical])
Artikelnummer: USB-374514
Hersteller Artikelnummer: 374514
Alternativnummer: USB-374514-20,USB-374514-100,USB-374514-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Asymmetrically hydrolyzes Ap4A to yield AMP and ATP. Plays a major role in maintaining homeostasis. Source: Recombinant protein corresponding to aa1-147 from human NUDT2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.8kD Amino Acid Sequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 43.8
UniProt: P50583
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.