NXNL2, Recombinant, Human, aa1-135, His-SUMO-Tag (Nucleoredoxin-like protein 2)

Artikelnummer: USB-374521
Artikelname: NXNL2, Recombinant, Human, aa1-135, His-SUMO-Tag (Nucleoredoxin-like protein 2)
Artikelnummer: USB-374521
Hersteller Artikelnummer: 374521
Alternativnummer: USB-374521-20,USB-374521-100,USB-374521-1
Hersteller: US Biological
Kategorie: Molekularbiologie
May be involved in the maintenance of both the function and the viability of sensory neurons, including photoreceptors and olfactory neurons. Source: Recombinant protein corresponding to aa1-135 from human NXNL2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.7kD Amino Acid Sequence: MVDILGERHLVTCKGATVEAEAALQNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEARRPAPFEVVFVSADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHCNLCLLGSSDSLALAS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 30.7
UniProt: Q5VZ03
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.