Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions. Recombinant protein corresponding to aa2-109 from mouse Oncomodulin, fused to an N-terminal 6X His-Tag, expressed in Yeast (P51879) Amino Acid Sequence: SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
