OmpD, Recombinant, Salmonella Typhimurium, aa22-362, His-SUMO-Tag (Outer Membrane Porin Protein OmpD)

Artikelnummer: USB-374547
Artikelname: OmpD, Recombinant, Salmonella Typhimurium, aa22-362, His-SUMO-Tag (Outer Membrane Porin Protein OmpD)
Artikelnummer: USB-374547
Hersteller Artikelnummer: 374547
Alternativnummer: USB-374547-20,USB-374547-100,USB-374547-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Forms pores that allow passive diffusion of small molecules across the outer membrane. Full-length recombinant protein corresponding to aa22-362 from Salmonella typhimurium Outer Membrane Porin Protein OmpD, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.6kD Amino Acid Sequence: AEVYNKDGNKLDLYGKVHAQHYFSDDNGSDGDKTYARLGFKGETQINDQLTGFGQWEYEFKGNRTESQGADKDKTRLAFAGLKFADYGSFDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTGRTTGVATYRNTDFFGLVEGLNFAAQYQGKNDRDGAYESNGDGFGLSATYEYEGFGVGAAYAKSDRTNNQVKAASNLNAAGKNAEVWAAGLKYDANNIYLATTYSETLNMTTFGEDAAGDAFIANKTQNFEAVAQYQFDFGLRPSIAYLKSKGKNLGTYGDQDLVEYIDVGATYYFNKNMSTFVDYKINLLDDSDFTKAAKVSTDNIVAVGLNYQF Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 53.6
UniProt: P37592
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.