Outer-Membrane Lipoprotein Carrier Protein, Recombinant, E. coli, aa22-203, His-Tag (LolA)

Produktübersicht

• Artikelname: Outer-Membrane Lipoprotein Carrier Protein, Recombinant, E. coli, aa22-203, His-Tag (LolA)
• Artikelnummer: USB-374576
• Hersteller Artikelnummer: 374576
• Alternativnummer: USB-374576-20,USB-374576-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Participates in the translocation of lipoproteins from the inner membrane to the outer membrane. Only forms a complex with a lipoprotein if the residue after the N-terminal Cys is not an aspartate (The Asp acts as a targeting signal to indicate that the lipoprotein should stay in the inner membrane). Source: Recombinant protein corresponding to aa22-203 from E. coli Outer-Membrane Lipoprotein Carrier Protein, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~22.3kD Amino Acid Sequence: DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 22.3
• UniProt: A7ZYJ5
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.