OXNAD1, Recombinant, Human, aa18-312, His-SUMO-Tag (Oxidoreductase NAD-binding Domain-containing Protein 1)

Artikelnummer: USB-374580
Artikelname: OXNAD1, Recombinant, Human, aa18-312, His-SUMO-Tag (Oxidoreductase NAD-binding Domain-containing Protein 1)
Artikelnummer: USB-374580
Hersteller Artikelnummer: 374580
Alternativnummer: USB-374580-20,USB-374580-100,USB-374580-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa18-312 from human OXNAD1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~49.2kD Amino Acid Sequence: AIRIEAASLRLTLSTLRHLTLTSIMKSKRKTDHMERTASVLRREIVSAAKVCGAASESPSVKSLRLLVADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFDPQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFPEKIACSLHVTKQTTQINAELKPYITEGRITEKEIRDHISKETLFYICGPPPMTDFFSKQLENNHVPKEHICFEKWW Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 49.2
UniProt: Q96HP4
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.