Oxyopinin-4a, Recombinant, Oxyopes Takobius, aa48-77, His-SUMO-Tag

Artikelnummer: USB-374582
Artikelname: Oxyopinin-4a, Recombinant, Oxyopes Takobius, aa48-77, His-SUMO-Tag
Artikelnummer: USB-374582
Hersteller Artikelnummer: 374582
Alternativnummer: USB-374582-20,USB-374582-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Disrupts cell membranes through the formation of pores (Probable). Has antibacterial activity against Gram-positive bacteria S.aureus (MIC=10uM) and B.subtilis (MIC=0.5uM) as well as Gram-negative bacteria P.fluorescens (MIC=1uM) and E.coli (MIC=0.5uM). Has hemolytic activity against human erythrocytes (EC(50)=7uM). Source: Recombinant protein corresponding to aa48-77 from oxyopes takobius Oxyopinin-4a, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~19.6kD Amino Acid Sequence: GIRCPKSWKCKAFKQRVLKRLLAMLRQHAF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 19.6
UniProt: F8J4S0
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.