Pal, Recombinant, Legionella Pneumophila, aa22-176, His-SUMO-Tag (Peptidoglycan-associated Lipoprotein)

Artikelnummer: USB-374604
Artikelname: Pal, Recombinant, Legionella Pneumophila, aa22-176, His-SUMO-Tag (Peptidoglycan-associated Lipoprotein)
Artikelnummer: USB-374604
Hersteller Artikelnummer: 374604
Alternativnummer: USB-374604-20,USB-374604-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Very strongly associated with the peptidoglycan. Source: Recombinant protein corresponding to aa22-176 from legionella pneumophila Peptidoglycan-associated Lipoprotein, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.8kD Amino Acid Sequence: CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 32.8
UniProt: P26493
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.