Papillomavirus Type 52 Protein E6, Recombinant, Human, aa1-148, His-SUMO-Tag (E6)

Artikelnummer: USB-374612
Artikelname: Papillomavirus Type 52 Protein E6, Recombinant, Human, aa1-148, His-SUMO-Tag (E6)
Artikelnummer: USB-374612
Hersteller Artikelnummer: 374612
Alternativnummer: USB-374612-20,USB-374612-100,USB-374612-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Transcriptional transactivator. Binds double-stranded DNA. Source: Recombinant protein corresponding to aa1-148 from human Papillomavirus Type 52 Protein E6, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.9kD Amino Acid Sequence: MFEDPATRPRTLHELCEVLEESVHEIRLQCVQCKKELQRREVYKFLFTDLRIVYRDNNPYGVCIMCLRFLSKISEYRHYQYSLYGKTLEERVKKPLSEITIRCIICQTPLCPEEKERHVNANKRFHNIMGRWTGRCSECWRPRPVTQV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 33.9
UniProt: P36814
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.