Parvalbumin beta-1, Recombinant, Theragra Chalcogramma, aa2-109, His-SUMO-Tag

Artikelnummer: USB-374620
Artikelname: Parvalbumin beta-1, Recombinant, Theragra Chalcogramma, aa2-109, His-SUMO-Tag
Artikelnummer: USB-374620
Hersteller Artikelnummer: 374620
Alternativnummer: USB-374620-20,USB-374620-100
Hersteller: US Biological
Kategorie: Molekularbiologie
In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions (By similarity). Source: Recombinant protein corresponding to aa2-109 from theragra chalcogramma Parvalbumin beta-1, fused to His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~31.4kD Amino Acid Sequence: SFAGVLADADVKAALAGCAAADSFNYKTFFKACGLAAKSHEEVKKAFFVIDQDQSGFIEEDELKLFLQTFGAGARELTAAETKAFLAAGDEDGDGMIGVDEFVTLVKA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 31.4
UniProt: Q90YK8
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.