Parvalbumin beta, Recombinant, Gadus Morhua subsp. Callarias, aa1-113, His-Tag

Produktübersicht

• Artikelname: Parvalbumin beta, Recombinant, Gadus Morhua subsp. Callarias, aa1-113, His-Tag
• Artikelnummer: USB-374621
• Hersteller Artikelnummer: 374621
• Alternativnummer: USB-374621-20,USB-374621-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions. Source: Recombinant protein corresponding to aa1-113 from gadus morhua subsp. callarias Parvalbumin beta, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.1kD Amino Acid Sequence: AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEEDELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDKWGAKG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 16.1
• UniProt: P02622
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.