Parvalbumin beta, Recombinant, Gadus Morhua, aa2-109, His-SUMO-Tag

Produktübersicht

• Artikelname: Parvalbumin beta, Recombinant, Gadus Morhua, aa2-109, His-SUMO-Tag
• Artikelnummer: USB-374622
• Hersteller Artikelnummer: 374622
• Alternativnummer: USB-374622-20,USB-374622-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions (By similarity). Source: Recombinant protein corresponding to aa2-109 from gadus morhua Parvalbumin beta, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.4kD Amino Acid Sequence: AFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 27.4
• UniProt: Q90YK9
• Reinheit: ~90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.