Pburs, Recombinant, Drosophila Melanogaster, aa21-141, His-Tag (Partner of Bursicon)

Produktübersicht

• Artikelname: Pburs, Recombinant, Drosophila Melanogaster, aa21-141, His-Tag (Partner of Bursicon)
• Artikelnummer: USB-374629
• Hersteller Artikelnummer: 374629
• Alternativnummer: USB-374629-20,USB-374629-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk. Source: Recombinant protein corresponding to aa21-141 from drosophila melanogaster Partner of Bursicon, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.8kD Amino Acid Sequence: LRYSQGTGDENCETLKSEIHLIKEEFDELGRMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVITLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 15.8
• UniProt: Q9VJS7
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.