PLA2G12A, Recombinant, Human, aa23-185, His-Tag (Group XIIA Secretory Phospholipase A2)

Artikelnummer: USB-374721
Artikelname: PLA2G12A, Recombinant, Human, aa23-185, His-Tag (Group XIIA Secretory Phospholipase A2)
Artikelnummer: USB-374721
Hersteller Artikelnummer: 374721
Alternativnummer: USB-374721-20,USB-374721-100
Hersteller: US Biological
Kategorie: Molekularbiologie
PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine. Source: Recombinant protein corresponding to aa23-185 from human PLA2G12A, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~20.3kD Amino Acid Sequence: QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 20.3
UniProt: Q9BZM1
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.