Pla2g2a, Recombinant, Rat, aa22-146, His-SUMO-Tag (Phospholipase A2, Membrane Associated)

Produktübersicht

• Artikelname: Pla2g2a, Recombinant, Rat, aa22-146, His-SUMO-Tag (Phospholipase A2, Membrane Associated)
• Artikelnummer: USB-374724
• Hersteller Artikelnummer: 374724
• Alternativnummer: USB-374724-20,USB-374724-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Thought to participate in the regulation of the phospholipid metabolism in biombranes including eicosanoid biosynthesis. Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Source: Recombinant protein corresponding to aa22-146 from rat Pla2g2a, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.1kD Amino Acid Sequence: SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 30.1
• UniProt: P14423
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.