PLP, Recombinant, Oncorhynchus Mykiss, aa150-218, His-Tag (Myelin Proteolipid Protein)

Artikelnummer: USB-374752
Artikelname: PLP, Recombinant, Oncorhynchus Mykiss, aa150-218, His-Tag (Myelin Proteolipid Protein)
Artikelnummer: USB-374752
Hersteller Artikelnummer: 374752
Alternativnummer: USB-374752-20,USB-374752-100
Hersteller: US Biological
Kategorie: Molekularbiologie
This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation. Source: Recombinant protein corresponding to aa150-218 from oncorhynchus mykiss PLP, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~11.7kD Amino Acid Sequence: PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molekulargewicht: 11.7
UniProt: P79826
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.