This neurotoxin binds at site 3 of insect voltage-activated sodium channels (Nav) and prolongs evoked axonal action potentials by a slowing down of sodium current inactivation. The toxin inhibits glutamate uptake from rat brain synaptosomes. It is highly toxic to house fly (Musca domestica), toxic to cockroach, but has no effect when intracerebroventricularly injected into mice. Source: Recombinant protein corresponding to aa35-82 from phoneutria nigriventer PNTx4, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~7.3kD Amino Acid Sequence: CGDINAACKEDCDCCGYTTACDCYWSKSCKCREAAIVIYTAPKKKLTC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
