POLR3K, Recombinant, Human, aa1-108, His-SUMO-Tag (DNA-directed RNA Polymerase III Subunit RPC10)

Artikelnummer: USB-374792
Artikelname: POLR3K, Recombinant, Human, aa1-108, His-SUMO-Tag (DNA-directed RNA Polymerase III Subunit RPC10)
Artikelnummer: USB-374792
Hersteller Artikelnummer: 374792
Alternativnummer: USB-374792-20, USB-374792-100, USB-374792-1
Hersteller: US Biological
Kategorie: Molekularbiologie
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway. Source: Recombinant protein corresponding to aa1-108 from human POLR3K, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~28.3kD Amino Acid Sequence: MLLFCPGCGNGLIVEEGQRCHRFSCNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.3
UniProt: Q9Y2Y1
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.