Ponticulin, Recombinant, Dictyostelium discoideum, aa23-118, His-Tag (PonA)

Artikelnummer: USB-374798
Artikelname: Ponticulin, Recombinant, Dictyostelium discoideum, aa23-118, His-Tag (PonA)
Artikelnummer: USB-374798
Hersteller Artikelnummer: 374798
Alternativnummer: USB-374798-20,USB-374798-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Binds F-actin and nucleates actin assembly. Major high affinity link between the plasma membrane and the cortical actin network. Source: Recombinant protein corresponding to aa23-118 from dictyostelium discoideum ponA, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.9kD Amino Acid Sequence: QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 11.9
UniProt: P54660
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.