PPP1R11, Recombinant, Human, aa1-126, GST-Tag (Protein Phosphatase 1 Regulatory Subunit 11)

Artikelnummer: USB-374820
Artikelname: PPP1R11, Recombinant, Human, aa1-126, GST-Tag (Protein Phosphatase 1 Regulatory Subunit 11)
Artikelnummer: USB-374820
Hersteller Artikelnummer: 374820
Alternativnummer: USB-374820-20,USB-374820-100,USB-374820-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Inhibitor of protein phosphatase 1. Source: Recombinant protein corresponding to aa1-126 from human PPP1R11, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41kD Amino Acid Sequence: MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 41
UniProt: O60927
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.