PPP1R1B, Recombinant, Human, aa1-168, GST-Tag (Protein Phosphatase 1 Regulatory Subunit 1B)

Artikelnummer: USB-374822
Artikelname: PPP1R1B, Recombinant, Human, aa1-168, GST-Tag (Protein Phosphatase 1 Regulatory Subunit 1B)
Artikelnummer: USB-374822
Hersteller Artikelnummer: 374822
Alternativnummer: USB-374822-20, USB-374822-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Inhibitor of protein-phosphatase 1. Source: Recombinant protein corresponding to aa1-168 from human PPP1R1B, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~45.7kD Amino Acid Sequence: MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 45.7
UniProt: Q9UD71
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.